Protein Info for Shewana3_4314 in Shewanella sp. ANA-3

Annotation: mercuric transporter MerT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 transmembrane" amino acids 10 to 36 (27 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details PF02411: MerT" amino acids 1 to 115 (115 residues), 197 bits, see alignment E=3.7e-63

Best Hits

Swiss-Prot: 94% identical to MERT_SHEPU: Mercuric transport protein MerT (merT) from Shewanella putrefaciens

KEGG orthology group: K08363, mercuric ion transport protein (inferred from 100% identity to shn:Shewana3_4314)

Predicted SEED Role

"Mercuric transport protein, MerT" in subsystem Mercury resistance operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L398 at UniProt or InterPro

Protein Sequence (115 amino acids)

>Shewana3_4314 mercuric transporter MerT (RefSeq) (Shewanella sp. ANA-3)
MSQKESNLPIIGGVIAAVGAGLCCAGPFVLLLLGVSGSWIGNLTLLEPYRPIFILLVLAL
FGFAGWKVYRPVEDCEPGTACAVPQVRKRRQVIFWLTALTALVLVTSNYWIVWFA