Protein Info for Shewana3_4226 in Shewanella sp. ANA-3

Annotation: cobyrinic acid a,c-diamide synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF18607: HTH_54" amino acids 16 to 107 (92 residues), 97 bits, see alignment E=1.2e-31 PF13614: AAA_31" amino acids 112 to 298 (187 residues), 87.1 bits, see alignment E=2.7e-28 PF01656: CbiA" amino acids 114 to 358 (245 residues), 37.8 bits, see alignment E=3.5e-13 PF09140: MipZ" amino acids 239 to 284 (46 residues), 24.4 bits, see alignment 3.4e-09

Best Hits

Swiss-Prot: 47% identical to PARA_ECOLX: Plasmid partition protein A (parA) from Escherichia coli

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_4226)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0L311 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Shewana3_4226 cobyrinic acid a,c-diamide synthase (RefSeq) (Shewanella sp. ANA-3)
MNEHFKARMRTTADRARKMLNTMSDSITQHKIEFGLDTFHQRYSKGALANLRGLTRKIVE
KSINEMEATGYQFDKKLNGSVEVYDLTVEQVVDIYKHRGHKALREKFERGYVVFLCNLKG
GVSKTVSTVNIAQALRCHSEMLQHDLKVLVLDIDPQSSASMFMSHKNSIGTIDNTVVQAV
FQDLTREELLDEFVIPTQVPGVDIIPSSIADAFIASQWEALCAQRFGSEINPFEALSRNV
CEKLINDYDFIFIDCGPHLDSLLKSALCAADVLVTPLPPSTVDLHSTLQYVTRIPEMLDH
LEAEGATTNLKGHLAFMSKYSQSEQDINSSMIANAVFAEDMMMASIPELSAFKRCAETFD
TVVSVHPGSYTGDSKALKKARESLDQFTLALFQHISRIRGSEYGI