Protein Info for Sama_3648 in Shewanella amazonensis SB2B

Annotation: F0F1 ATP synthase subunit B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00430: ATP-synt_B
  • amino acids 6 to 137 (132 residues), 134.8 bits, E=1e-43
• TIGR01144: ATP synthase F0, B subunit
  • amino acids 10 to 156 (147 residues), 190 bits, E=1.1e-60

Best Hits

Swiss-Prot: 100% identical to ATPF_SHEAM: ATP synthase subunit b (atpF) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 100% identity to saz:Sama_3648)

MetaCyc: 71% identical to ATP synthase Fo complex subunit b (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase F0 sector subunit b (EC 3.6.3.14)" (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See A1SBU4 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Sama_3648 F0F1 ATP synthase subunit B (RefSeq) (Shewanella amazonensis SB2B)
MNINATLIGQTVAFIIFVWFCMKYVWPPLMNAIEERQKRIADGLANADRAAKDLELAQAK
ATEQLKEAKATANEIIESANKRKAQIVEEAKAEADAERARIIAQGKAEIEAERNRVKEEL
RKQVATLALAGAEKILERSIDAAAHSDIVEKLVAEI