Protein Info for Sama_3575 in Shewanella amazonensis SB2B

Annotation: alpha/beta fold family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 95 to 246 (152 residues), 44 bits, see alignment E=2.3e-15 PF08386: Abhydrolase_4" amino acids 379 to 478 (100 residues), 70.7 bits, see alignment E=1e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3575)

Predicted SEED Role

"FIG032621: Hydrolase, alpha/beta hydrolase fold family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBM1 at UniProt or InterPro

Protein Sequence (507 amino acids)

>Sama_3575 alpha/beta fold family hydrolase (RefSeq) (Shewanella amazonensis SB2B)
MKLRNLRQLAHKAPRLAGAALLAMMALKSHAMATDILERPASDGPQSCYLKDIADRALCG
LVTVPENPAKPDGKQINIHYAVLPAIKPSFPGEAFLAIAGGPGQSAIDNAAGFNNMFRKV
RQTRDILLIDQRGTGRSNLLACSDKGLDPLAIDDENADMIAETRKCLAAQDADISQYGSV
TALGDFEAVRKALGYQKLHIYGVSYGSRMGQLYLRHYPEALATVTLDGVVPMQQSVLAIG
EAIDRAVELMLKDCRENTACQARFPALADELAAVHSRLAQSPVDIGVNHPLTGEPQQFLL
TRSKFAGVVRLALYSPTTRALLPLAIHEAAKGNYQSILGLYGMTLGSLDLASGMHNSVVC
GEDMHRIDADLQQRLQQSYYGKLMLDGLQKACSVWQVPAMESNFAEAVDTKLPVLLLSGE
LDPATPPSWAEMAMAEMHNARHLVAPYSGHGIARESCASGIIAEFVSEGAVDTLETDCLQ
KDIRRGFYLNASTVEPLPVVTPLANKE