Protein Info for Sama_3569 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 727 TIGR03549: YcaO domain protein" amino acids 2 to 723 (722 residues), 1489.8 bits, see alignment E=0 PF02566: OsmC" amino acids 32 to 126 (95 residues), 33 bits, see alignment E=1e-11 TIGR00702: YcaO-type kinase domain" amino acids 159 to 546 (388 residues), 336 bits, see alignment E=3.1e-104 PF02624: YcaO" amino acids 205 to 535 (331 residues), 222.5 bits, see alignment E=1.4e-69 PF18381: YcaO_C" amino acids 552 to 723 (172 residues), 253.9 bits, see alignment E=1.2e-79

Best Hits

KEGG orthology group: K09136, ribosomal protein S12 methylthiotransferase (inferred from 82% identity to sfr:Sfri_0738)

Predicted SEED Role

"FIG01057284: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBL5 at UniProt or InterPro

Protein Sequence (727 amino acids)

>Sama_3569 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MEIKVNFLDNLRLEAKFDDFTVVADQPIRYKGDGSAPSPFDYFLASSALCAAYFVKVYCV
SRDIPTEGIRLSQNNIVDPENRYNQQFKIQVELPESISDKDREGILRSIDRCTVKKVVQT
GPEFVIETVENLDEDAQAMLMVTPDADHSTFIVGKDLPLEQTIANMTAKLAELGMKIEIS
SWRNLVPNVWSLHIRDAASPMCFTNGKGATKESALCSALGEFIERLSCNFFYNDQYFGEE
IANAEFVHYPNEKWFPLEEDDSLPAGLLDEYCLDIYDNDGELCGSHLVDTNSGNYERGIC
AIPYIRHSDGETVYFPSNLIENLFLSNGMSAGNNLAEAKVQCLSEIFERAVKRQIIEEEI
ALPDVPKDVLAKYPSIVAGIDALEAQGFPVVVKDASLGGQFPVMCVTLMNPRTGGVFASF
GAHPSLEVALERSLTELLQGRSFEGLNDVQKPTFNSMAVQEPENFVEHFIDSTGVISWRF
FSAKHDYEFVEWDFSGTNEEESTALFGILEDLGLEAYIAEFTALGSACRILVPGYSEVYP
VTDLIWDNTNKALDFREDILNLHRLSDDELADLVERLEESELDNYTDIITLIGIEFDENT
VWGQLTILELKLLCYLALGELEAAQELTETFLQYNDNTVKRGLFYQAMSAVLEISLDDEL
ALEDYRHNLTRMFGEETMDAVIGSVEGSVRFYGLTPTSMKLEGLDRHQRLIESYKKLHAA
RAKLAGL