Protein Info for Sama_3490 in Shewanella amazonensis SB2B

Annotation: cytochrome oxidase assembly (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 75 to 96 (22 residues), see Phobius details amino acids 103 to 123 (21 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 170 to 188 (19 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 301 to 324 (24 residues), see Phobius details PF02628: COX15-CtaA" amino acids 5 to 317 (313 residues), 269.6 bits, see alignment E=1.7e-84

Best Hits

KEGG orthology group: K02259, cytochrome c oxidase subunit XV assembly protein (inferred from 100% identity to saz:Sama_3490)

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBD6 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Sama_3490 cytochrome oxidase assembly (RefSeq) (Shewanella amazonensis SB2B)
MTLRNLLKLTLACTLMVILLGAYTRLSDAGLGCPDWPGCYGHFKVPSAAHELAKAESLFP
EHTIDPAKAWPEMIHRYIASSLGLLVILVLVACYRLKEAPRKLPIFILLLILFQGALGAW
TVTMKLMPVVVMSHLLGGFTLLSLLTLLYLRTSGFRIPGGDPGMRQYQRLALACVGVLVA
QILLGGWTSSNYAALACTELPFCEGDWTTNLKIADAFSPFQGTHPSFEFGVLDYHARMTI
HIAHRFGAMITAALLGLLAFRIINRAHSKVLRNAGWVLAGFLVLQLGLGISNVVLHLPLA
IAVAHNLGAAFLLVTLVFINYALWRKA