Protein Info for Sama_3467 in Shewanella amazonensis SB2B

Annotation: cell division ABC transporter, ATP-binding protein FtsE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 TIGR02673: cell division ATP-binding protein FtsE" amino acids 1 to 214 (214 residues), 290.6 bits, see alignment E=3.7e-91 PF00005: ABC_tran" amino acids 18 to 165 (148 residues), 128.7 bits, see alignment E=2.5e-41

Best Hits

Swiss-Prot: 67% identical to FTSE_ECOL6: Cell division ATP-binding protein FtsE (ftsE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K09812, cell division transport system ATP-binding protein (inferred from 100% identity to saz:Sama_3467)

Predicted SEED Role

"Cell division transporter, ATP-binding protein FtsE (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SBB3 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Sama_3467 cell division ABC transporter, ATP-binding protein FtsE (RefSeq) (Shewanella amazonensis SB2B)
MIRFEQVSKVYPGGQKALSDVNFHLRRGEMAFLTGHSGAGKSTLLKLITVIERASAGKVF
INGHDIADISRHHVPYLRREIGMIFQNHHLLMDRSVFDNVALPLVIEGFSHGEIKKRVAA
ALDMVGLYGKERHNPIMLSGGEQQRVGIARAIVNKPALLLADEPTGNLDPKLSMDILRLF
ETFNDAGTSVLIATHDLGLIARMKYRTLTLRQGRMLGAREIGEPLRPGV