Protein Info for Sama_3438 in Shewanella amazonensis SB2B

Annotation: isoquinoline 1-oxidoreductase, alpha subunit, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF00111: Fer2" amino acids 5 to 56 (52 residues), 38.6 bits, see alignment E=1.2e-13 PF13085: Fer2_3" amino acids 35 to 77 (43 residues), 32.8 bits, see alignment E=8.7e-12 PF01799: Fer2_2" amino acids 72 to 141 (70 residues), 92.7 bits, see alignment E=1.8e-30

Best Hits

Swiss-Prot: 53% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 100% identity to saz:Sama_3438)

MetaCyc: 53% identical to isoquinoline 1-oxidoreductase subunit alpha (Brevundimonas diminuta)
Isoquinoline 1-oxidoreductase. [EC: 1.3.99.16]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.3.99.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB84 at UniProt or InterPro

Protein Sequence (151 amino acids)

>Sama_3438 isoquinoline 1-oxidoreductase, alpha subunit, putative (RefSeq) (Shewanella amazonensis SB2B)
MTSLKINGRLFTLDADPKMPLLWALRDLMGLTGTKYGCGAGLCGACTVHVDGEPMRACLT
SIKSLEGKSVTTIEGLADEQLKDSWRRHKVPQCGFCQAGQLMSAAALVSKHPRPSDSQID
EAMAGNICRCGTYTRIRAAIKDYQGKQEAKS