Protein Info for Sama_3427 in Shewanella amazonensis SB2B

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 TIGR01818: nitrogen regulation protein NR(I)" amino acids 7 to 467 (461 residues), 763.3 bits, see alignment E=4.6e-234 PF00072: Response_reg" amino acids 7 to 116 (110 residues), 86.7 bits, see alignment E=3.7e-28 PF00158: Sigma54_activat" amino acids 141 to 307 (167 residues), 240.8 bits, see alignment E=1.9e-75 PF14532: Sigma54_activ_2" amino acids 142 to 312 (171 residues), 82 bits, see alignment E=1.5e-26 PF07724: AAA_2" amino acids 161 to 278 (118 residues), 30.3 bits, see alignment E=1.3e-10 PF07728: AAA_5" amino acids 165 to 283 (119 residues), 32 bits, see alignment E=3.5e-11 PF02954: HTH_8" amino acids 429 to 467 (39 residues), 52.7 bits, see alignment 8.8e-18

Best Hits

Swiss-Prot: 71% identical to NTRC_ECO57: DNA-binding transcriptional regulator NtrC (glnG) from Escherichia coli O157:H7

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to saz:Sama_3427)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB73 at UniProt or InterPro

Protein Sequence (470 amino acids)

>Sama_3427 response regulator receiver protein (RefSeq) (Shewanella amazonensis SB2B)
MSISEQVWILDDDSSIRWVLEKALKSARITSASFAAAESLWQALELSQPLVIVSDIRMPG
TDGLTLLERIGLHYPHIPVIIMTAHSDLDSAVAAYQSGAFEYLPKPFDIDEAIALVERAL
THASEQAPQANTSEPVKAPEIIGEAPAMQEVFRAIGRLSRSSISVLINGQSGTGKELVAG
ALHKHSPRKDKPFIALNMAAIPKDLIESELFGHEKGAFTGAAGVRQGRFEQANGGTLFLD
EIGDMPLDVQTRLLRVLADGQFYRVGGHSPVQVDVRIIAATHQDLERLVQQGQFREDLFH
RLNVIRVHLPPLRERREDIPQLTRHFLAAAAREIGVEAKILAKETAAKLQQLPWPGNVRQ
LENTCRWLTVMASGQEILPQDLPPELFKDPVVHHAGAVVAGDWESALRDIVDRRLGEGES
DLLADMQPTFERIMLEVALKHTQGHKQEAARRLGWGRNTLTRKLKELEMD