Protein Info for Sama_3422 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 TIGR04344: 5-histidylcysteine sulfoxide synthase" amino acids 9 to 452 (444 residues), 700.4 bits, see alignment E=9.6e-215 PF12867: DinB_2" amino acids 28 to 163 (136 residues), 35.6 bits, see alignment E=4.4e-12 PF03781: FGE-sulfatase" amino acids 196 to 452 (257 residues), 100.9 bits, see alignment E=3.4e-32 TIGR04345: putative 4-mercaptohistidine N1-methyltranferase" amino acids 467 to 707 (241 residues), 348 bits, see alignment E=2.7e-108 PF13489: Methyltransf_23" amino acids 492 to 638 (147 residues), 37.6 bits, see alignment E=6.7e-13 PF13847: Methyltransf_31" amino acids 506 to 639 (134 residues), 31.9 bits, see alignment E=3.7e-11 PF08241: Methyltransf_11" amino acids 512 to 635 (124 residues), 31.8 bits, see alignment E=6.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3422)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB68 at UniProt or InterPro

Protein Sequence (709 amino acids)

>Sama_3422 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MELLTAPPTPLLSGEDTQIKRAEIKAYFQNSWARYESLFSLISNDDAYFKKAEPLRHPLI
FYFGHTATFFINKLKLGKYIDERINDHFESMFAIGVDEMSWDDLNDAHYDWPQVDEVRAY
RNAVRALIESLIDTMPLELPIGQSSLAWAILMGIEHERIHLETSSVIIRQLPLEDLTPSM
QWPECRDYGEAPDNPLIQVKGGDISLGKVDEDLTYGWDNEYGRSRHHISDFRASEKLVSN
GEFMAFVKAGGYKEPKWWSDEGNAWREYTNANMPRFWRHIDGRWYQRNLCSEIPLPLNWP
VEVNQLEAKAFCNWKAATTERSIRLPTEAEWYWLRRELEGDMTAIGTAPAWREVPGNLNL
AHYASSCPVNRFRQGRFFDLVGNVWQWTETPIDGFPGFAVHPLYDDFSTPTFDGKHNLIK
GGSWISTGNEAIAASRYAFRRHFYQHAGFRYVESSQSPDEGVKMNVYETDELISQYLEFH
YGREYFGVANFCVKGVQDALAEINLERHTRALDIGCSVGRASFELARHFDAVDAIDFSAR
FIQQAYALKEQGEKRYTIRTEGELVEYRTASLASLGYNEVKHKIDFLQGDALNLKPRFSG
YDLVYASNLIDRLNEPKAFLEQIHSRINAGGYLVIASPYTWLEDYTPKANWLGGIKVNGE
NFTTLDGLTETLIPHFELVAVKEVPFVIRETKRKFQHSLSEMSIWRKRQ