Protein Info for Sama_3416 in Shewanella amazonensis SB2B

Name: glnA
Annotation: glutamine synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR00653: glutamine synthetase, type I" amino acids 4 to 468 (465 residues), 681 bits, see alignment E=3.8e-209 PF03951: Gln-synt_N" amino acids 14 to 95 (82 residues), 113.9 bits, see alignment E=2.2e-37 PF00120: Gln-synt_C" amino acids 103 to 466 (364 residues), 462.8 bits, see alignment E=6.9e-143

Best Hits

Swiss-Prot: 85% identical to GLN1B_VIBCH: Glutamine synthetase (glnAv) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01915, glutamine synthetase [EC: 6.3.1.2] (inferred from 100% identity to saz:Sama_3416)

MetaCyc: 77% identical to glutamine synthetase (Escherichia coli K-12 substr. MG1655)
Glutamate--ammonia ligase. [EC: 6.3.1.2]

Predicted SEED Role

"Glutamine synthetase type I (EC 6.3.1.2)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Glutamine synthetases or Peptidoglycan Biosynthesis (EC 6.3.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.1.2

Use Curated BLAST to search for 6.3.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB62 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Sama_3416 glutamine synthetase (RefSeq) (Shewanella amazonensis SB2B)
MSVENVLKQLKDLEVKFVDLRFTDTKGKEQHVSIPTHQVDADFFEDGKMFDGSSIAGWKG
INESDMVLMPDATTFVLDPFTEETTAIIRCDILEPGTMTGYDRDPRSIAKKAEEYLRATG
IADTVLMGPEPEFFLFDDVRFGTDMSGTFVKIDAKEAAWNSSTSYEDGNTGHRPFVKGGY
FPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAGQNEIATRFNTLTKKADEIQILK
YVVHNMAHAYGKTATFMPKPIVGDNGSGMHVHQSLAKDGVNLFAGDKYGGLSETALYYIG
GIIKHARALNAFTNPSTNSYKRLVPHFEAPVMLAYSARNRSASIRIPVVPSPKGRRIETR
FPDPTANPYLGFAALLMAGLDGIQNKIHPGDAMDKDLYDLPAEEAAEIPTVAESLDVALA
ALDADREFLTKGGVFSNDFIDSYIRLKTAEAERVNRTTHPLEFEMYYSL