Protein Info for Sama_3400 in Shewanella amazonensis SB2B

Annotation: trypsin-like serine protease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00089: Trypsin" amino acids 204 to 343 (140 residues), 28.3 bits, see alignment E=1.5e-10 PF13365: Trypsin_2" amino acids 204 to 337 (134 residues), 74 bits, see alignment E=2.2e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3400)

Predicted SEED Role

"Bll0849 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB46 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Sama_3400 trypsin-like serine protease (RefSeq) (Shewanella amazonensis SB2B)
MRFLCLALAVALCANLSGCANTRLNANKLPKGVAVNKSITLPVDVSVAYYVPKIQMDSRF
YLEKWNIWVEPGSALSDGVRDAFNAYFSNAVLLDRASDDAVGLVIDLDPEWEFVSGKAVM
TLSYKVLNGGDKPLKEGKKTFKADIGYVGDNSGMYNAAMRATQLVIVDVLNSLKPTAAGY
PAQLAMKATNPLQLANMEKPVSSGTGFYINETGQLLTAAHVLRECMVTKVQTPTQSYDAT
VDASSTLLDLAVVSTGAPAERYLPLRKGSEIFLGEAVTNVGYPLQGLLAASPNLTRGNVS
SMNALKGSVGQFQFSAPIQPGSSGGPVVSDGGELLGVTVATLNAAKLIESGALPQNVNFA
LDARHVARFLDKHQVAFHQVEPNLKGDIRISNDAALSSVVQLACYQ