Protein Info for Sama_3388 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 799 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 265 to 284 (20 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 355 to 377 (23 residues), see Phobius details amino acids 384 to 403 (20 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details amino acids 661 to 678 (18 residues), see Phobius details amino acids 685 to 706 (22 residues), see Phobius details amino acids 712 to 732 (21 residues), see Phobius details amino acids 744 to 764 (21 residues), see Phobius details amino acids 770 to 791 (22 residues), see Phobius details PF03176: MMPL" amino acids 205 to 398 (194 residues), 22.5 bits, see alignment E=2.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3388)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB34 at UniProt or InterPro

Protein Sequence (799 amino acids)

>Sama_3388 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MALGGSKITDKPQTASRAGLRLALWLLLLAAALVFGIKTLKHRDVVETDILAMLPHLQQD
ALTSRALDSLESRLANESYLVLTGKDKAATIEAAKGMMAELASSPAFVSVRSGSELDPKE
IYRLYFPARFNLLTESQRSLLENGKLDVLIKQAKIALYSAFGFANSELISEDPLLLFPAL
MQSFGKGHRLGEEGGILLGNSDGQTAAIIMAKGKDSVFSPKAQEAQISAINAAFTKVNLG
KQLSLLKAGALFHALEATQSAKAEVSLIGSLSLAGVVVLVLLSFRSLMPLLMASLTLASA
MVSASLFTILIFGKLHLLTLVFGTSLIGIAIDYSFHFYAERSGRDESASQTLSRILPALT
LALATSVLAYLALGFTPFPGMQQVAAFCGGGLIGAYLTLYLAYPMLADSRIQAASAAITL
ASRFLTPFEAAGSKALVIGSLTVLLVCIPGLGQLDSRDDIRSLQQGSAALMAEEANVRTL
LSGGVDNQFLLVRAESMQTLLARLEALAPVLAKAEKDQLLQSHVNFADYLPSQARQMADH
NLQQQIYGHELGEILARLGLEPELEPDLRAKYQAGAQTPIEADAFFDTRLGANLKPLLLE
PTANEANHPESTAREWGAMVLLGGIQNLPALNQAVATLPGVTLVDKVGDISKLMGEYRHT
TLWLLVLALLIAFGVFALRHPWKLAAAMVAVPALAALLSLSLLGLLGSPLTLFHALALLL
VFGIGVDYSLFFAKDENREHGHRVMLAVLLSASSTTLAFGLLALSNTPAIHYFGLTLALG
IGFTLLLSPLIHTFKRKLK