Protein Info for Sama_3384 in Shewanella amazonensis SB2B

Annotation: glycosyl transferase, group 2 family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 473 to 491 (19 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 5 to 138 (134 residues), 61 bits, see alignment E=1.4e-20 PF03279: Lip_A_acyltrans" amino acids 340 to 549 (210 residues), 48.4 bits, see alignment E=7.9e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3384)

Predicted SEED Role

"FIG143263: Glycosyl transferase / Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SB30 at UniProt or InterPro

Protein Sequence (552 amino acids)

>Sama_3384 glycosyl transferase, group 2 family protein (RefSeq) (Shewanella amazonensis SB2B)
MRVAIIIPNYNHTHAIERTLETLEPLGLPVFLVNDGSNEATCHLLMVLDAKYPWVTLLHH
PFNRGKGAAVMTGLRAAYKAGFSHALQVDADGQHTLDDIPTLLSAANEHPEAVISGRPQY
DDSVPKGRLYGRYITHFWVWVETLSFDIQDSMCGFRVYPLKATEALFLSEQLGERMDFDI
EVLVKLYWRGVDVIHVPTAVIYPEDGVSHFQGFADNVRISALHTRLFFGMLKRLPSLLGR
GRKQTHWSSISERGSYWGIKLLAESYRFGGHWLCRAIMYPVIAYFFMTGGAARKASIEFL
ERVQALEPNHPQLQPRVSWRHSLKHFLAFGNAALDRIDAWCDRIKLSEVDFPERALLADM
LTRGQGGVLLVSHLGNLELCRAISIHQRKVKVNVMVMTANAENFNKVLKQLNPDSDLNLI
HINELDPSTSIMLADKIAAGELVVIAGDRTASGNAGRVVEVPFLGETAPFPQGPFILASL
LDCPVFLMFCLREQGRYRVHVEPFADTLKGPRAGRSERIQNAVERYAERLEHYARKEPLQ
WFNFFDFWRRGQ