Protein Info for Sama_3290 in Shewanella amazonensis SB2B

Annotation: putative acyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details PF01553: Acyltransferase" amino acids 72 to 213 (142 residues), 51.9 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3290)

Predicted SEED Role

"Acyltransferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAT6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Sama_3290 putative acyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MRALLSLIRGSLAFLGYTLNTLFWFVPILLLGLVKLLPIPALRKLMSHLVDGCASNWISV
NGFIQNVLHPVRIEVLGDAELTRDEWYMVIANHQSWVDILVLQRIFNRKIPFLKFFLKQQ
LLYVPVLGLAWWALDFPFMRRYSTAELKKNPKLKGKDIEITRRACAKFKDKPVSVMNFVE
GTRFQAAKHKKQNSPFQHLLRPKAGGMAFALSAMGEQIHKLVDVAIYYPGKVPSFWDFIS
GQVDEIRVHVTVADIASEMRGDYINDREFKQDFQEQLNQIWARKDGILKQLSGEKEIKTE
VSEQHA