Protein Info for Sama_3278 in Shewanella amazonensis SB2B

Annotation: threonine dehydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01124: threonine ammonia-lyase, biosynthetic
  • amino acids 24 to 528 (505 residues), 768.1 bits, E=1.9e-235
• PF00291: PALP
  • amino acids 38 to 308 (271 residues), 260.9 bits, E=1.6e-81
• PF00585: Thr_dehydrat_C
  • amino acids 344 to 434 (91 residues), 79 bits, E=2e-26
  • amino acids 445 to 528 (84 residues), 81.7 bits, E=2.9e-27

Best Hits

Swiss-Prot: 61% identical to ILVA_ECOLI: L-threonine dehydratase biosynthetic IlvA (ilvA) from Escherichia coli (strain K12)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 100% identity to saz:Sama_3278)

MetaCyc: 61% identical to threonine deaminase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (3/3 steps found)
• L-threonine degradation V (1/2 steps found)
• hypoglycin biosynthesis (4/14 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism
• Valine, leucine and isoleucine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

See A1SAS4 at UniProt or InterPro

Protein Sequence (531 amino acids)

>Sama_3278 threonine dehydratase (RefSeq) (Shewanella amazonensis SB2B)
MLDFSGCGDRDKSEVKPVDLAHYYLQKILLSSVYDVAKVTPLSHMGKLSARLGQEIYLKR
EDMQPVHSFKLRGAYNRISQLTQPECERGVVCASAGNHAQGVALSASSRGIDAVIVMPTT
TPDIKIDAVRRRGGNVLLHGESFDQANAHAQHLAQTEGRVYIAPFDDEAVIAGQGTVAQE
MLQQQRDLELVFVPVGGGGLVAGIAAYYKAVRPSVKIIGVEPEDAACLKAAMAAGEPVTL
SQVGLFADGVAVKRIGAEPFRIAKHYVDEVVTVSSDEICAAVKDIFEDTRAIAEPAGALS
LAGLKKYLAQTTPALAEAGKPARKVAAILSGANVNFHSLRYVSERCELGEQKEAVLAVKV
PEVPGSFLKFCELLGKRAMTEFNYRFSGRDSAVVFAGIRLSGGQSELKEIIASLTSGGFE
VQDLSSDETAKLHVRYMVGGHPTEPLSERLFSFEFPEYPGALLKFLTTLGSRWNISLFHY
RNHGAAFGRVLAGFEVPEGDNEAFGRFLTELGFVWQEETHSPAYRLFLGSK