Protein Info for Sama_3272 in Shewanella amazonensis SB2B

Annotation: urease accessory protein UreJ (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details PF04955: HupE_UreJ" amino acids 8 to 185 (178 residues), 198 bits, see alignment E=9.5e-63 PF13795: HupE_UreJ_2" amino acids 27 to 130 (104 residues), 30.4 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 100% identity to saz:Sama_3272)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAR8 at UniProt or InterPro

Protein Sequence (194 amino acids)

>Sama_3272 urease accessory protein UreJ (RefSeq) (Shewanella amazonensis SB2B)
MRKGIGLWCLLFSAGASAHEVALGGGFGAGFSHPVLGLDHLLAMLSVGMVSTRLGRHAIW
QVPLAFLCFMSLGAVLGITDIALPLVEAGIALSVMLLGLAIAFNRALPLWPAMLAVAVFG
IFHGHAHGMEMPTLASPWLYGLGFILGTATIHLIGVFTGLLLAMKERRYPLTRITGAGIA
AMGTLFLIGTVLPG