Protein Info for Sama_3264 in Shewanella amazonensis SB2B

Annotation: putative diguanylate phosphodiesterase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details PF16448: LapD_MoxY_N" amino acids 24 to 146 (123 residues), 137.8 bits, see alignment E=3.5e-44 PF00672: HAMP" amino acids 173 to 221 (49 residues), 26.5 bits, see alignment 1.4e-09 PF00990: GGDEF" amino acids 239 to 388 (150 residues), 48.5 bits, see alignment E=1.8e-16 PF00563: EAL" amino acids 408 to 634 (227 residues), 167.7 bits, see alignment E=5.7e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_3264)

Predicted SEED Role

"Membrane bound c-di-GMP receptor LapD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAR0 at UniProt or InterPro

Protein Sequence (639 amino acids)

>Sama_3264 putative diguanylate phosphodiesterase (RefSeq) (Shewanella amazonensis SB2B)
MTLFRQLYSLLFGLFLLVITALAYVQFTETKSFLTKQMESDLNNVSNSLGLLLVPALETG
DIATAETLINVIFEGGYYQQVKLTWLVDGKQQEWNNSLEIQGVPQWFINLGIFGTIKRES
TITSGWLQLAQLEVTAHPGFGYHELWRILTNTIIVFSILFLVAIFLARFGLSWILKPLHI
VSEHAKSIANRQFGPELAIPKTSELKEVVIAFNSMSSQLKQIFSSLDEEVTALRKKNLVD
QVSGLPNRQYLVGRINSWLSEPGSGALFMAKFDWLEEVHAKYGYQVRDETIKLLSEKLQS
QLEEIAPGVVARIAAFEFAFLVFDVDKELISKYLQTLIRTVNQEISKAGGKPNEHFAIGI
AERIGSMTVSDILAQSDNALQTAIKSGKVYHWFESSEEQMFTREQWREKLSSAINAKLFQ
FRWQPIQLTDGAGLLQHELYCQLEIGDKLAHAGQFMPYVELLSLGALLDKCLIQKVHDIH
LLERNFEPVAINLTHQSLTDTDFHQWLQQFLRSTPLADRLCFDIPESGVYSNPEACEALC
AIIRDNGAKFGIDHFGRQFGSMSYLQTLRPSYVKLDQSFAYYDENQHNAELCRALVNVAR
GLEIQVIVTGIQEKPQLDRFIPLKTTAYQGFIAPPVNVS