Protein Info for Sama_3202 in Shewanella amazonensis SB2B

Annotation: ubiquinone/menaquinone biosynthesis methlytransferase UbiE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 21 to 250 (230 residues), 335.4 bits, E=6.4e-104
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 25 to 250 (226 residues), 281.6 bits, E=1.8e-88
• PF13489: Methyltransf_23
  • amino acids 49 to 233 (185 residues), 56.4 bits, E=1.3e-18
• PF01135: PCMT
  • amino acids 61 to 168 (108 residues), 28 bits, E=7.4e-10
• PF05175: MTS
  • amino acids 62 to 184 (123 residues), 23.6 bits, E=1.4e-08
• PF13847: Methyltransf_31
  • amino acids 63 to 178 (116 residues), 81.1 bits, E=3.1e-26
• PF13649: Methyltransf_25
  • amino acids 67 to 164 (98 residues), 82 bits, E=1.6e-26
• PF08241: Methyltransf_11
  • amino acids 68 to 168 (101 residues), 76.7 bits, E=7.1e-25
• PF08242: Methyltransf_12
  • amino acids 68 to 166 (99 residues), 51.7 bits, E=5e-17

Best Hits

Swiss-Prot: 100% identical to UBIE_SHEAM: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 100% identity to saz:Sama_3202)

MetaCyc: 75% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of chorismate metabolism (50/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (7/8 steps found)
• menaquinol-10 biosynthesis (2/2 steps found)
• menaquinol-11 biosynthesis (2/2 steps found)
• menaquinol-12 biosynthesis (2/2 steps found)
• menaquinol-13 biosynthesis (2/2 steps found)
• menaquinol-7 biosynthesis (2/2 steps found)
• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (5/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

See A1SAJ8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Sama_3202 ubiquinone/menaquinone biosynthesis methlytransferase UbiE (RefSeq) (Shewanella amazonensis SB2B)
MSDGTSNSTHFGFKTVEADKKADLVAGVFHSVAAKYDIMNDVMSFGIHRLWKRFTIETAG
ARPGMKVLDLAGGTGDLTAKFSRLVGDRGEVVLADINDSMLKVGRAKLRDLGVVGNVSYV
QANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMQRVLKPGGKLLVLEFSKPQHEVMR
KLYDLYSFKILPKMGEFIAQDAGSYEYLAESIRMHPDQDTLKGMMQDAGLEQVDYINMTD
GVVALHRGYKF