Protein Info for Sama_3195 in Shewanella amazonensis SB2B

Annotation: acetyl-CoA carboxylase, biotin carboxyl carrier protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 TIGR00531: acetyl-CoA carboxylase, biotin carboxyl carrier protein" amino acids 52 to 138 (87 residues), 129.4 bits, see alignment E=8.2e-42 PF00364: Biotin_lipoyl" amino acids 66 to 138 (73 residues), 77.2 bits, see alignment E=6.8e-26

Best Hits

KEGG orthology group: K02160, acetyl-CoA carboxylase biotin carboxyl carrier protein (inferred from 100% identity to saz:Sama_3195)

Predicted SEED Role

"Biotin carboxyl carrier protein of acetyl-CoA carboxylase" in subsystem Fatty Acid Biosynthesis FASII

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SAJ1 at UniProt or InterPro

Protein Sequence (142 amino acids)

>Sama_3195 acetyl-CoA carboxylase, biotin carboxyl carrier protein (RefSeq) (Shewanella amazonensis SB2B)
MAMDLRKIKKLIELVQESGINELEVKEGEESVRIIRHGNLPPQTVITEISPKATSSVQAH
EAGHRVLSPMVGTFYRAPSPEARPFVELGTEVAVGDTLAVIEAMKMMNQIAADRAGTVKA
ILVENGTAVEFDQPLFVIGDAD