Protein Info for Sama_3083 in Shewanella amazonensis SB2B

Annotation: arabinose-5-phosphate isomerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF01380: SIS" amino acids 41 to 173 (133 residues), 111.7 bits, see alignment E=2.3e-36 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 46 to 315 (270 residues), 359.2 bits, see alignment E=7.5e-112 PF00571: CBS" amino acids 269 to 322 (54 residues), 37.9 bits, see alignment 1.8e-13

Best Hits

Swiss-Prot: 62% identical to KDSD_YERPE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Yersinia pestis

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to saz:Sama_3083)

MetaCyc: 60% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA79 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Sama_3083 arabinose-5-phosphate isomerase (RefSeq) (Shewanella amazonensis SB2B)
MVDRKQLRQWGSKVIDIEKAALDNLYQFVDSDAFADACELILRCTGKVIVMGMGKSGHIG
NKISATLASTGTPAFFVHPGEASHGDLGVLSDNDIVLAISNSGESSEILTLMPVIKRRGI
PIISMTGKPESTMAKHSLLHLCIKVPEEACPLGLAPTSSTTATLVMGDALAVALLQAKGF
TKDDFAMSHPGGALGRKLLLHVSDVMHKGDELPLVQDDICITDALYEISKKGLGMTAIVN
ASGALEGIFTDGDLRRVIDAQINLRQTSIADVMTRNCITIGEHILAAEALKLMDEKNING
LIVIDAERRPIGALNMLDMVKAGVI