Protein Info for Sama_3079 in Shewanella amazonensis SB2B

Annotation: mce-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR04430: outer membrane lipid asymmetry maintenance protein MlaD" amino acids 4 to 151 (148 residues), 185.2 bits, see alignment E=2.8e-59 PF02470: MlaD" amino acids 39 to 117 (79 residues), 67.1 bits, see alignment E=6.7e-23

Best Hits

Swiss-Prot: 58% identical to MLAD_ECOLI: Intermembrane phospholipid transport system binding protein MlaD (mlaD) from Escherichia coli (strain K12)

KEGG orthology group: K02067, putative ABC transport system substrate-binding protein (inferred from 100% identity to saz:Sama_3079)

Predicted SEED Role

"Uncharacterized ABC transporter, periplasmic component YrbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA75 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Sama_3079 mce-related protein (RefSeq) (Shewanella amazonensis SB2B)
MLSRKVEIWVGLFLLAGIAAFLVLVFKVANVEVQAGNSSYTLYARFANVGGLKVRSPVKV
GGVVVGRVSKIELDPERLVAVVSLSMDGRYRNFPETSSLSILTSGLLGEQFLGLTPGFVD
DDIAMLKDGDRIADTKSALVLEDLIGQFLYSMGSKD