Protein Info for Sama_3058 in Shewanella amazonensis SB2B

Annotation: replicative DNA helicase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 TIGR00665: replicative DNA helicase" amino acids 23 to 461 (439 residues), 583.9 bits, see alignment E=9.8e-180 PF00772: DnaB" amino acids 24 to 125 (102 residues), 122.9 bits, see alignment E=8.3e-40 PF03796: DnaB_C" amino acids 203 to 459 (257 residues), 362.8 bits, see alignment E=1.5e-112 PF13481: AAA_25" amino acids 219 to 382 (164 residues), 33.1 bits, see alignment E=6.8e-12

Best Hits

Swiss-Prot: 76% identical to DNAB_SALTY: Replicative DNA helicase (dnaB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 100% identity to saz:Sama_3058)

MetaCyc: 74% identical to replicative DNA helicase (Escherichia coli K-12 substr. MG1655)
RXN0-4261 [EC: 5.6.2.3]

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12 or 5.6.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1SA54 at UniProt or InterPro

Protein Sequence (468 amino acids)

>Sama_3058 replicative DNA helicase (RefSeq) (Shewanella amazonensis SB2B)
MSQEAAFKPKGKLKDAQVEAIKMPPHSIEAEQSVLGGLMLDAEAWDKVAEAVVREDFYSR
SHRLIFSAMQKLVEQGQPLDLITVSEQLELNNELDDAGGFAYLGEIAKNTPSAGNILSYA
EIVRERAVVREMIRVAHEIADAGYNPEGRDSSALLDLAETKVFKIAEQRANANEGPEDIK
AILEKTVDKIEQLYNNPHNGVTGVSSGFSDLDRMTAGFQSGDLVIVAARPSMGKTTFAMN
LCEYAAMNEDKPVLIFSLEMPSEQIMMRMLASLGRVDQTKVRTGQLDDEDWARVSSTMGL
MLEQGKMYIDDSSGLTPTEVRSRARRVAREWGGLSMIMVDYLQLMQVPALADNRTLEIAE
ISRSLKALAKELEIPVIALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEV
YNNDSQDKGTAEIIIGKQRNGPIGRVRLTFQGQFSRFDNYAGPQFEED