Protein Info for Sama_2950 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF01571: GCV_T" amino acids 25 to 135 (111 residues), 39.3 bits, see alignment E=4.1e-14 TIGR03317: folate-binding protein YgfZ" amino acids 182 to 244 (63 residues), 91.3 bits, see alignment E=1.4e-30 PF21130: YgfZ_barrel" amino acids 237 to 303 (67 residues), 45.3 bits, see alignment E=7.2e-16

Best Hits

KEGG orthology group: K06980, (no description) (inferred from 100% identity to saz:Sama_2950)

Predicted SEED Role

"Folate-dependent protein for Fe/S cluster synthesis/repair in oxidative stress"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9U6 at UniProt or InterPro

Protein Sequence (321 amino acids)

>Sama_2950 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MTFTVSQAAWALDSEGPALTLSLLNHLGLVSVTGEQGNSFIHGQVTADISALEPGQWRWG
AHCDPKGRMLATFRTFKLGDALMMLEPRSALEVSLAQLKKYAVFSKAELVDMSSELTLLG
VSGPEAAGFVARHFGTAEADVFSTEQGTVLKDGERFILILDKANACALIEKSGQPLYGAG
VWQALEIRAGYPNIAAGHASEYIPQMCNLQALGGISFNKGCYMGQETVARTKYRGGNKRA
LYILFGESQTPVRLESTLEIAVEGGYRKAGNIIEVVSRGNKVLMTAVLANDTAPDAVLRL
ADDHEASFTLLPLPYSLEEEA