Protein Info for Sama_2927 in Shewanella amazonensis SB2B

Annotation: holin-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details PF03788: LrgA" amino acids 32 to 124 (93 residues), 76.1 bits, see alignment E=8.5e-26

Best Hits

KEGG orthology group: K06518, holin-like protein (inferred from 100% identity to saz:Sama_2927)

Predicted SEED Role

"Holin-like protein CidA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9S3 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Sama_2927 holin-like protein (RefSeq) (Shewanella amazonensis SB2B)
MTLSEGKVRLKSGAKRASLTLLQAAAICLLAWLAHALVLYFSLPVPGGVVGLAVLLALLS
LKWVPEKALQAGAAWLLGDLLLFFIPPVISVIQYEAMIEQYGARMLGFLVAGSVTVLLGT
AWVVDKAFKFERGLHLARAGGRL