Protein Info for Sama_2889 in Shewanella amazonensis SB2B

Annotation: putative sodium/sulfate symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 transmembrane" amino acids 6 to 37 (32 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details amino acids 95 to 118 (24 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 389 to 407 (19 residues), see Phobius details amino acids 413 to 429 (17 residues), see Phobius details amino acids 436 to 454 (19 residues), see Phobius details amino acids 470 to 490 (21 residues), see Phobius details amino acids 497 to 514 (18 residues), see Phobius details amino acids 520 to 543 (24 residues), see Phobius details amino acids 556 to 578 (23 residues), see Phobius details PF03600: CitMHS" amino acids 21 to 524 (504 residues), 165.3 bits, see alignment E=3.2e-52 PF02080: TrkA_C" amino acids 210 to 283 (74 residues), 36.5 bits, see alignment E=5.6e-13 amino acids 298 to 355 (58 residues), 34 bits, see alignment 3.3e-12 PF00939: Na_sulph_symp" amino acids 417 to 573 (157 residues), 43.2 bits, see alignment E=4.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2889)

Predicted SEED Role

"Sulfate permease, Trk-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9N5 at UniProt or InterPro

Protein Sequence (583 amino acids)

>Sama_2889 putative sodium/sulfate symporter (RefSeq) (Shewanella amazonensis SB2B)
MTLEQYWVIGMVLTLVGTLVCTRLPASWVFAAVALLSYVSNSLSLNELSASFTDSSLLTL
VLLLLASVALEKTRLISWVGVQLSRGGLRTVLTKLWFSTSVLSSFTANTAVVASLIGAIK
RNQRYAPSKLMLPMAFAATFGGTLTLIGTSTNLVINSFLDRAGLPLLQFFTTTGVAIGVV
LAGMLVLWLIADRLPITEKAEDEQNLPYFLEARIAAGSILIGKTVSDAGLRHLRKLYLAE
IQRVIGDEKTTIIPVTPEEVLQQGDVLLFAGDMESVAVLQEIAGLTLYGHHTMNGQSLAE
AIISHSSSLNGVSLKDAQFRERFDAVVVAVRRGHERLRGGLGTIELQAGDALLLVPGKQF
GDASQRLDKEFLLVNGVDSATRLSPRRSAWVLASFAAVIGLAMFNVLPLLKGLTLFVAGL
LLTQVVTLSELKRRFPIDIVLIVGGALALSQAMGNSGISKLLADELTAGFSGVHYFFVMA
GVYLLTLFLTELMSNNAAAALVCPIAISLAQGLGIDPMPFIMAVLFGASASFISPWGYQT
NLLVFTVGNYRLKQYVGVGIPMAIAYTFAVLALIPLMFPFHSL