Protein Info for Sama_2862 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 279 to 307 (29 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details PF12704: MacB_PCD" amino acids 74 to 248 (175 residues), 37.5 bits, see alignment E=3.1e-13 PF02687: FtsX" amino acids 286 to 398 (113 residues), 50.2 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to saz:Sama_2862)

Predicted SEED Role

"ABC transporter permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9K8 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Sama_2862 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MTAIKPILSAMLRSRSGPLLLLAQIILSVAIVANAAFIIQQRVDLMARPSGITESESFEF
SVFNFGEEMDLFARDERDLEILRNLPGIKSAAPINMVPLSGSGWSDRFVDGPDPKNAKSL
PQFAFYLSDEELVNALGLRLVEGRTFHKGQVLSGFEDKSIQREAILSQPLAKAFWGEESP
IGKVVYQGDDEPITVVGVVERLHGAWVDDRNLENSVIMNIDFNGRSPNAGYMIRSEAADI
PQLKETIKAALLKDEPRRVIRGFSTIAENREQNYASHAMMVFVLSCMIILLLVITALGLS
GMVMFNIERRTRQIGTRRALGATRGNILGWFLTENYLLLGVGALVGSLLAFELSRQLMDF
FSLDALAWQYPAVTVALLFVVTTIAVIIPARRAAAISPSIATRSV