Protein Info for Sama_2855 in Shewanella amazonensis SB2B

Annotation: coniferyl aldehyde dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF00171: Aldedh" amino acids 10 to 449 (440 residues), 301 bits, see alignment E=6.5e-94

Best Hits

KEGG orthology group: K00154, coniferyl-aldehyde dehydrogenase [EC: 1.2.1.68] (inferred from 100% identity to saz:Sama_2855)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9K1 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Sama_2855 coniferyl aldehyde dehydrogenase (RefSeq) (Shewanella amazonensis SB2B)
MNAATQMQPTPSGEVAAMQQTFERQRQEFAKHSYPSLSERKNALSLLKLTLLEQQDALIN
ALSRDYGHRSADDSRISDIMPVVNHINYTLSNLKRWAKPSRRHAGILLAPASVNVTYQPK
GVVGIIVPWNFPVMLSLGPLVTAIAAGNSAMLKMSEFTPETNKVIKSLLAKTFAEKKVAV
IEGEADVAAAFSSLPFDHLLFTGSTAVGKHVMRAASANLTPVTLELGGKSPVIVAPDMDM
DTAVERMIYGKCLNAGQICVAPDYVLVPRGKEDAFIKAYQDKFAALYGKVETNKDYGAII
NERQWQRLMQVLDDAKAQGANVHSASGEPPLGTLRKLPTQLLTQVTDEMLVMQDEIFGPL
LPVVPYDSLDEALSYINARPRPLALYLMSFDTATQDKVLSSTHSGGVCINETVFHVAADD
APFGGIGPSGMGHYHGEEGFRTFSHAKTVLKRGRLNTGKLVHPPYGNAIQTLLMKVFLR