Protein Info for Sama_2783 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 66 to 90 (25 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 279 to 297 (19 residues), see Phobius details PF04018: VCA0040-like" amino acids 13 to 258 (246 residues), 346.8 bits, see alignment E=3.9e-108

Best Hits

KEGG orthology group: K08974, putative membrane protein (inferred from 100% identity to saz:Sama_2783)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S9C9 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Sama_2783 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MNNLLTYFKGLAMGAADVVPGVSGGTIAFITGILDKLLDSVRAINPSLIKVIREEGGKAA
WARINGTFLVCLLGGILTSIFSLAKLISYLLAHHPIPVWSFFFGLILVSVWHMLRQVKGF
DAGRIALFILGAVVAWGITVLTPTEIPATYLNVFLGGAIAICAMILPGISGSFILLLLGL
YPAVLAAAKGLQLDVLACFAAGAVCGILSFSHLLSMLLRKFHDATIFFLTGLMLGTLGKI
WPWKETLSWRTNSHGEQVPLAQQNLTPWGFEQLTGESSQLGFAIVCALVGIALVLIIEKL
GEGKPSR