Protein Info for Sama_2753 in Shewanella amazonensis SB2B

Annotation: Na+/H+ antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 47 to 64 (18 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 168 to 184 (17 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 295 to 312 (18 residues), see Phobius details amino acids 359 to 380 (22 residues), see Phobius details amino acids 392 to 415 (24 residues), see Phobius details amino acids 426 to 451 (26 residues), see Phobius details amino acids 466 to 486 (21 residues), see Phobius details PF03600: CitMHS" amino acids 59 to 434 (376 residues), 122.5 bits, see alignment E=1.1e-39

Best Hits

Swiss-Prot: 69% identical to NHAD_ALKAM: Na(+)/H(+) antiporter NhaD (nhaD) from Alkalimonas amylolytica

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2753)

Predicted SEED Role

"Na+/H+ antiporter NhaD type" in subsystem Na(+) H(+) antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S999 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Sama_2753 Na+/H+ antiporter (RefSeq) (Shewanella amazonensis SB2B)
MKAKHLNGGVHRIAGMAISFMLALFAPAALASSGSGGEWLDLTGATVGYLAITIFVLAYI
LVMLEEKLHLRKSKPVLVAAGIIWGMLGFVYSQHGMPQVAEEAFKHNLLEYAELLLFLLV
AMTYINAMEERGLFDALRAWMVSRGFSLRQVFWLCGILAFFISPVADNLTTALLMCAVVM
KVGGDNRRFIGIACINIVVAANAGGAFSPFGDITTLMVWQKGIVPFGEFFDLFIPAVVNF
MVPALVMSFFIGNERPAAVSERVFMRRGAKRIVALFLLTIASAVLAHSMLGMPPVLGMMT
GLGFLQFFGFFLRKTFNHSVAKAIAKAEAEKNRERLTYLGNVVPFDVFSRVARAEWDTLL
FFYGVVLCVGGLGFMGYLSLVSEAMYTHWDATYANITVGLLSAVVDNIPVMFAVLTMNPD
MALGQWLLVTLTAGVGGSLLSIGSAAGVALMGQARGIYTFGTHLKWTPVIALGYVASILV
HMWLNAATFH