Protein Info for Sama_2735 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 72 to 100 (29 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 173 to 195 (23 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details PF05661: DUF808" amino acids 4 to 295 (292 residues), 384.8 bits, see alignment E=1.3e-119

Best Hits

Swiss-Prot: 59% identical to YEDI_ECOLI: Inner membrane protein YedI (yedI) from Escherichia coli (strain K12)

KEGG orthology group: K09781, hypothetical protein (inferred from 100% identity to saz:Sama_2735)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S981 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Sama_2735 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MAGASLLTLLDDIATILDDVSVMSKVAAKKTAGVLGDDLALNAQQVTGVNADRELPVVWA
VAKGSFLNKLILVPLALLISAFVPWLVTPLLMFGGLFLCFEGFEKLWHARAKHVPVEGED
AHEALVPKGMDPQEYEKQKVKGAIRTDFVLSAEIIAITLGVVAEQPFMTQVATLSIIAVL
MTIGVYGLVAGIVKLDDLGLWLSRKSAALAKMVGNLLLAAAPKLMKLLSVVGTAAMFMVG
GGILTHGIHVLHDGINAAAARVGAIEAIGPVLEFFTPSALNLLFGIVAGAVAVLVMTLIA
KFKPAKAAN