Protein Info for Sama_2707 in Shewanella amazonensis SB2B

Annotation: gamma-carboxymuconolactone decarboxylase subunit-like protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02627: CMD
  • amino acids 46 to 130 (85 residues), 73.5 bits, E=5.5e-25

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 100% identity to saz:Sama_2707)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (2/4 steps found)
• aromatic compounds degradation via β-ketoadipate (2/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (2/11 steps found)
• superpathway of aerobic toluene degradation (4/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (6/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

See A1S953 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Sama_2707 gamma-carboxymuconolactone decarboxylase subunit-like protein (RefSeq) (Shewanella amazonensis SB2B)
MKQLLQATHQQPCTTRMVAAEPQLAYGGFMADNTGIAHKIFGDFAPKLAYLTDDILFGPV
WGGEELSQRDRSLITVAALITQHRPEQLRFHLTKALENGLSHAELIEVITQLAFYAGWPS
AMTALDVAREVFAPAKSAQ