Protein Info for Sama_2679 in Shewanella amazonensis SB2B

Annotation: cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 245 to 269 (25 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 24 to 293 (270 residues), 140.3 bits, see alignment E=1.5e-44 TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 24 to 552 (529 residues), 584.2 bits, see alignment E=1.5e-179 PF00005: ABC_tran" amino acids 365 to 508 (144 residues), 96.5 bits, see alignment E=3.2e-31

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to saz:Sama_2679)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S925 at UniProt or InterPro

Protein Sequence (597 amino acids)

>Sama_2679 cysteine/glutathione ABC transporter membrane/ATP-binding component (RefSeq) (Shewanella amazonensis SB2B)
MDKSLEKQLALWLKSRKAACGPFLLLSVALGLFAGLLLIGQAWLLARMLSAVVMQGETIQ
ALGAEIAALLGLIIARAIVAWARERVSFEAGRRLRTELRAAVLNHLSALGPAFIKGKPLG
SWGAVVLEQIEDLHDFYARYLPQLSLAALIPLVILACVFPLNWAAGLILLGTAPLIPLFM
ILVGMGAADANRKHFAALSRLSGHFMDRLRGIVTLRLFDRAEAEGRAIEKASDEFRSRTM
AVLRMAFLSSAVLEFFAAVSLALVAVYFGFSYLGHLDFGHYGQSISLFTGLFVLMLAPEF
YQPLRDMGTHYHAKAQAVAAAEALSELLAIDTDTQQGKQPLPHHLDIEARDLCIYSHQGA
LIAGPLSFSVRQGERLAIVGPSGAGKSSLLHALLGFLPCKGTLTVGGMPFTELDMGQWRG
AVAWLGQEPHLFHGSIRDNIAMGRALGDEQIQQLLAKAQIADFVAGSADGLSHAIAEGGG
GVSVGQAQRLALARALAGQPQVFLLDEPGASLDVDSERKVMESIMRESEGLSLVMVSHRL
EALTQLDRVLVMDGGAIVESGTAIELANANGLFADLLSESGLARSLDIPMCDGELRS