Protein Info for Sama_2674 in Shewanella amazonensis SB2B

Annotation: phosphate transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 345 to 365 (21 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details PF01384: PHO4" amino acids 27 to 410 (384 residues), 402.7 bits, see alignment E=7.4e-125

Best Hits

Swiss-Prot: 59% identical to Y1604_HAEIN: Putative phosphate permease HI_1604 (HI_1604) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 100% identity to saz:Sama_2674)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S920 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Sama_2674 phosphate transporter (RefSeq) (Shewanella amazonensis SB2B)
MVDIFVTYGPWLIAIAAAFGFLMAWGIGANDVANAMGTSVGSNAITIKQAIIIAMIFEFA
GAYLAGGEVTSTIRNGIIDAGYFTEVPHLLVYGMIAALLAAGIWLVVASALGWPVSTTHS
IVGAIIGFAAVGVGSEAVAWGKVTGIVGSWIVTPAISGFIAFLIFQSAQKLIFNTDNPLE
NAKRYVPFYMALAGFVMSLVTIKKGLKHVGLHFSALEAYALAIAIGIAVAIVGKMFIGRL
KMAEKADRHTQFANVEKVFAVLMVVSACCMAFAHGSNDVANAIGPLAAVVSVVNSGGEIA
AKSALVWWILPLGAFGIVFGLAIFGKRVMQTIGKNITHLTPSRGFAAELAAASTVVIASG
TGLPISTTQTLVGAVLGVGMARGIAAINIGVVRNIVVSWVVTLPAGAGLSIIFFYVIWGV
FGG