Protein Info for Sama_2606 in Shewanella amazonensis SB2B

Annotation: putative lipoprotein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 54 (54 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 37 to 280 (244 residues), 274 bits, see alignment E=5.1e-86 PF13512: TPR_18" amino acids 61 to 200 (140 residues), 183.9 bits, see alignment E=5.9e-58 PF13525: YfiO" amino acids 62 to 266 (205 residues), 244 bits, see alignment E=3.9e-76 PF13174: TPR_6" amino acids 66 to 96 (31 residues), 16 bits, see alignment 4.4e-06 amino acids 171 to 190 (20 residues), 12.5 bits, see alignment (E = 5.8e-05) PF13432: TPR_16" amino acids 106 to 153 (48 residues), 20.9 bits, see alignment 1.3e-07

Best Hits

Swiss-Prot: 45% identical to BAMD_ECO57: Outer membrane protein assembly factor BamD (bamD) from Escherichia coli O157:H7

KEGG orthology group: K05807, putative lipoprotein (inferred from 100% identity to saz:Sama_2606)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8V2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Sama_2606 putative lipoprotein (RefSeq) (Shewanella amazonensis SB2B)
MLSVTIGCFPFYREMEEFLTTTSKELNSSMYKFAKGSAVALFALALGACSSSGSQEDLVL
SQKSPEALYAQARTSMELGNFSKAVKSLEALDSRFPFGAHKTQVQLDMIYAYYKLDDTPQ
AIANIDRFLRLNPTHPDVDYVQYMRGLVNMQADSYLFHDMMNIDRTDRDPKNAMDAFKDF
ERLIKTYPNSKYAADAHQRMQFLKNRLARYSIQVAEYYVKMNAWSAAAVRAQTVMESFPG
TPSTERALEIMAQSYDELGQEQLKKHVLMVMQENFPANEMLQN