Protein Info for Sama_2587 in Shewanella amazonensis SB2B
Annotation: rRNA large subunit methyltransferase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RLMH_SHEAM: Ribosomal RNA large subunit methyltransferase H (rlmH) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
KEGG orthology group: K00783, hypothetical protein (inferred from 100% identity to saz:Sama_2587)MetaCyc: 80% identical to 23S rRNA m3psi1915 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11592 [EC: 2.1.1.177]
Predicted SEED Role
"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.1.1.177
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A1S8T3 at UniProt or InterPro
Protein Sequence (156 amino acids)
>Sama_2587 rRNA large subunit methyltransferase (RefSeq) (Shewanella amazonensis SB2B) MKLQLIAVGTKMPDWVTRGFEEYQRRFPRDMALELVEIPAGKRGKNADIARILQKEGEQM LAAIPKGNHIVTLDLPGKNWTTPELASALSKWQLDGRDVSLLIGGPEGLAPACKQAAAQS WCLSALTLPHPLVRVVVAESLYRAWSINNNHPYHRE