Protein Info for Sama_2568 in Shewanella amazonensis SB2B

Annotation: outer membrane lipoprotein LolB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00548: outer membrane lipoprotein LolB" amino acids 38 to 195 (158 residues), 90.7 bits, see alignment E=4.5e-30 PF03550: LolB" amino acids 44 to 194 (151 residues), 134 bits, see alignment E=2.3e-43

Best Hits

Swiss-Prot: 100% identical to LOLB_SHEAM: Outer-membrane lipoprotein LolB (lolB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 100% identity to saz:Sama_2568)

Predicted SEED Role

"Outer membrane lipoprotein LolB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8R4 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Sama_2568 outer membrane lipoprotein LolB (RefSeq) (Shewanella amazonensis SB2B)
MINLRRFTKFTLAGLTALSLLGGCSVTPKVALQPVSVENASDAKAWELKGKLLIRTNGDK
VSANLFWLNTPDNAELRLTSMLGTTVLLLTQNRDGATLEVDGKRYSDLSPQRLLDGLSGF
TLPIDALPFWITGQPMAGDEVEFDTLNRPKTIISADGEWTINISSWQTQSGAPVPRMLEL
THASAVIKLQTNEWQALANATGSKGAR