Protein Info for Sama_2567 in Shewanella amazonensis SB2B

Name: hemA
Annotation: glutamyl-tRNA reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 TIGR01035: glutamyl-tRNA reductase" amino acids 4 to 413 (410 residues), 466.7 bits, see alignment E=3.5e-144 PF05201: GlutR_N" amino acids 6 to 152 (147 residues), 192 bits, see alignment E=1e-60 PF01488: Shikimate_DH" amino acids 168 to 302 (135 residues), 164.6 bits, see alignment E=2.9e-52 PF03807: F420_oxidored" amino acids 181 to 245 (65 residues), 22.9 bits, see alignment E=2.2e-08 PF00745: GlutR_dimer" amino acids 316 to 408 (93 residues), 66.6 bits, see alignment E=4.2e-22

Best Hits

Swiss-Prot: 100% identical to HEM1_SHEAM: Glutamyl-tRNA reductase (hemA) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to saz:Sama_2567)

MetaCyc: 58% identical to glutamyl-tRNA reductase (Escherichia coli K-12 substr. MG1655)
Glutamyl-tRNA reductase. [EC: 1.2.1.70]

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8R3 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Sama_2567 glutamyl-tRNA reductase (RefSeq) (Shewanella amazonensis SB2B)
MSLVAIGINHKTATVDLREKVAFSPDKIHDAMRSLACTTSSNEAVIVSTCNRTELYCNNA
RAEEVIHWLESYHNLSHDELMPCVYHHEGQEAVRHLMRVASGLDSLVLGEPQILGQVKQS
FAKAKEAGTVAVTLDRLFQSTFSVAKKVRTETEIGTAAVSVAFAAVSMAKHIFSSLASTK
VLLIGAGETIELVARHLKENGVSSMVVANRTVERAQAMCEEFGATAITLSQIPDFLPKAD
IVISSTASPLPILGKGMVEKALKQRRHQPMLLVDIAVPRDIEAEVGELDDAFLYTVDDLQ
SIIEQNMASRKEAAEQAEVIAQEQSFLFMDWIRSLESVDSIREYRTASMAIKDELVERAL
NKLAQGADGEQVILELANKLTNRLIHAPTQALTTASRQGDLNTLGQLRTALGLDKH