Protein Info for Sama_2548 in Shewanella amazonensis SB2B

Annotation: rRNA (guanine-N(2)-)-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF26049: RLMG_N" amino acids 14 to 190 (177 residues), 176.2 bits, see alignment E=3.1e-55 PF05175: MTS" amino acids 209 to 380 (172 residues), 179.2 bits, see alignment E=2.7e-56 PF00891: Methyltransf_2" amino acids 236 to 349 (114 residues), 24.7 bits, see alignment E=6.9e-09 PF03602: Cons_hypoth95" amino acids 237 to 329 (93 residues), 30.2 bits, see alignment E=1.8e-10 PF06325: PrmA" amino acids 240 to 348 (109 residues), 43.5 bits, see alignment E=1.5e-14 PF13847: Methyltransf_31" amino acids 241 to 348 (108 residues), 53 bits, see alignment E=1.7e-17 PF13649: Methyltransf_25" amino acids 242 to 344 (103 residues), 49.9 bits, see alignment E=2.2e-16 PF08242: Methyltransf_12" amino acids 243 to 346 (104 residues), 33.7 bits, see alignment E=2.5e-11 PF08241: Methyltransf_11" amino acids 244 to 347 (104 residues), 30.7 bits, see alignment E=2e-10

Best Hits

Swiss-Prot: 100% identical to RLMG_SHEAM: Ribosomal RNA large subunit methyltransferase G (rlmG) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to saz:Sama_2548)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8P4 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Sama_2548 rRNA (guanine-N(2)-)-methyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MTTRFSAFLSGTPCELDLHRFPATSDPNLQAWDAADEHLLKYLNESNTELAAKFLVINDS
FGALTCALATARSDADIVFAADGRTAHLGCKANLASNGLASAKVDYQDCTNLGSFAKGRQ
ILMKLPKNLNFLTDTLSQLSQTLAAGDVILMGAKAKHINQSLLALIAKAVGPATASLTWK
KTRIITITADGNPRPVSKPSVWDVPEHGLKVTNLSNVFAASKLDIGARLMMANLPQGHFS
SVIDLGCGNGVLALKAAQTYPDARLYLVDESAMAVESARQNWALNALDEGRAEFIWDDCL
SHLPNEVQADLVLCNPPFHQGEAITDHIAWQMFNDAKRALKPGGLLHIVGNRHLGYHIKL
KRLFGNCKTIASNGKFVILQAVK