Protein Info for Sama_2490 in Shewanella amazonensis SB2B

Annotation: A/G-specific adenine glycosylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR01084: A/G-specific adenine glycosylase" amino acids 10 to 278 (269 residues), 399.9 bits, see alignment E=3.2e-124 PF00730: HhH-GPD" amino acids 39 to 172 (134 residues), 86.4 bits, see alignment E=2.5e-28 PF10576: EndIII_4Fe-2S" amino acids 196 to 212 (17 residues), 20.2 bits, see alignment (E = 9.1e-08) PF14815: NUDIX_4" amino acids 238 to 349 (112 residues), 73.4 bits, see alignment E=2e-24

Best Hits

Swiss-Prot: 60% identical to MUTY_SALTY: Adenine DNA glycosylase (mutY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 100% identity to saz:Sama_2490)

MetaCyc: 63% identical to adenine DNA glycosylase (Escherichia coli K-12 substr. MG1655)
RXN0-2661 [EC: 3.2.2.31]

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.- or 3.2.2.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8I7 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Sama_2490 A/G-specific adenine glycosylase (RefSeq) (Shewanella amazonensis SB2B)
MSEQTARIPFGKRIVLWYDKHGRKSLPWQQNKTPYKVWVSEIMLQQTQVATVIPYFERFM
ASFPTVNDLANAHEDEVLHHWTGLGYYARARNLHKAAQLIRDEHGGEFPTEFDAVLALPG
IGRSTAGAVLSLSLGQHHPILDGNVKRVLARHGAIEGWPGEKRVDTALWQLTEALTPKED
IQKYNQAMMDMGANICTRSRPKCGECPVAIDCKAQLAGRQGEFPGKKPKKTIPAREGWML
ILQQANTVKLIKRPPSGIWGGLWCFPQFDSKQALHAFVEANGLDAENLTLLDGFRHTFSH
FHLDIQPVKLRLGSTQTEALIMEDNLSLWYNLLQGENLGLAAATERILASLVSELKQESG
GSAAAHKE