Protein Info for Sama_2477 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR00044: pyridoxal phosphate enzyme, YggS family" amino acids 1 to 231 (231 residues), 294.3 bits, see alignment E=3.1e-92 PF01168: Ala_racemase_N" amino acids 23 to 231 (209 residues), 80 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 61% identical to PLPHP_HAEIN: Pyridoxal phosphate homeostasis protein (HI_0090) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06997, (no description) (inferred from 100% identity to saz:Sama_2477)

Predicted SEED Role

"Hypothetical protein YggS, proline synthase co-transcribed bacterial homolog PROSC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8H4 at UniProt or InterPro

Protein Sequence (235 amino acids)

>Sama_2477 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MTTIADRLSLAQQRIVQAAQISSRNPSEIKLLAVSKTKPASDIQAAYDAGQRLFGENYVQ
EGVQKITDLTSPCPNIEWHFIGPLQSNKSRPVAEHFDWLHTLDREKLAIRLNEQRPAELA
PLNVLIQVNISDEESKSGVKPEDITALADAVCRLPRLRLRGLMAIPAPTDDKERAQTELA
NMQRLFKSLQQSHGTLGQIDTLSMGMSGDLELAIDNGSTLVRVGSAIFGERDYSR