Protein Info for Sama_2474 in Shewanella amazonensis SB2B

Annotation: glutathione peroxidase, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00255: GSHPx
  • amino acids 36 to 131 (96 residues), 80.9 bits, E=2.6e-27

Best Hits

KEGG orthology group: K00432, glutathione peroxidase [EC: 1.11.1.9] (inferred from 100% identity to saz:Sama_2474)

Predicted SEED Role

"Glutathione peroxidase family protein"

MetaCyc Pathways

• reactive oxygen species degradation (4/4 steps found)
• glutathione-peroxide redox reactions (2/3 steps found)

KEGG Metabolic Maps

• Arachidonic acid metabolism
• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.9

Use Curated BLAST to search for 1.11.1.9

Sequence Analysis Tools

See A1S8H1 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Sama_2474 glutathione peroxidase, putative (RefSeq) (Shewanella amazonensis SB2B)
MAETVETQNAAEHTAGTQVACPAYLNHEFRKLHSSESVNLCDIAAGKPVLFINTASNCGF
TPQFKALELLNKEYGPKGLVLVGFPSDDFFQEENDEKDTAKVCYLNYGVTFTMLATSAVR
GGDANPVFEYLGEKAGSPKWNFYKYLVSADGKEVTAFNSRVKPDSLELKAAIEAALPKAL