Protein Info for Sama_2448 in Shewanella amazonensis SB2B

Annotation: sensory box protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1036 transmembrane" amino acids 5 to 24 (20 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 70 to 97 (28 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 22 to 188 (167 residues), 111.4 bits, see alignment E=1.7e-35 TIGR00229: PAS domain S-box protein" amino acids 206 to 322 (117 residues), 47.3 bits, see alignment E=2.1e-16 amino acids 326 to 453 (128 residues), 46 bits, see alignment E=5.5e-16 amino acids 453 to 575 (123 residues), 71.1 bits, see alignment E=9.1e-24 PF13426: PAS_9" amino acids 216 to 316 (101 residues), 34.5 bits, see alignment E=9.5e-12 amino acids 349 to 447 (99 residues), 24.6 bits, see alignment E=1.1e-08 amino acids 467 to 569 (103 residues), 55.3 bits, see alignment E=3.2e-18 PF08447: PAS_3" amino acids 227 to 294 (68 residues), 29.4 bits, see alignment 3.6e-10 amino acids 353 to 442 (90 residues), 78 bits, see alignment E=2.5e-25 amino acids 478 to 560 (83 residues), 41.3 bits, see alignment E=6.8e-14 PF00989: PAS" amino acids 331 to 445 (115 residues), 27.8 bits, see alignment E=9.6e-10 amino acids 461 to 567 (107 residues), 47.5 bits, see alignment E=7.3e-16 PF13188: PAS_8" amino acids 460 to 498 (39 residues), 24.4 bits, see alignment (E = 9.2e-09) PF08448: PAS_4" amino acids 463 to 571 (109 residues), 35.9 bits, see alignment E=3.5e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 579 to 741 (163 residues), 154.8 bits, see alignment E=1.7e-49 PF00990: GGDEF" amino acids 581 to 738 (158 residues), 174.1 bits, see alignment E=9.3e-55 PF00563: EAL" amino acids 758 to 994 (237 residues), 255.4 bits, see alignment E=2.1e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2448)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S8E6 at UniProt or InterPro

Protein Sequence (1036 amino acids)

>Sama_2448 sensory box protein (RefSeq) (Shewanella amazonensis SB2B)
MTQGIFFPLVQNAALLLALVYLYDAIPWLKQQRIRWVWHIMLGLVIGAIGMTIMSARYEF
AEGIYFDTRGVLLSVSGLYFGAVPTLIASAMMAIYRYGMGGPAMVAGIAGIAFAAAMGIL
WRIPWQKNLIEVSTGSLLLLGMLVNIGSLLCFFIMPFDLAWELVSTIGTTVMLVCPLATL
LLARLLARRLEIERDEKIKLQDDFLFRSQFNVGNIGIAITSVDKRWIKVNPRLCQMLKYS
EKELLSMNWEQMSHEEDISVDLAHFNQMLAGAIDQYELNKRFYAKDGSIVYTHMTVACKR
IAGKVQLVIAGFMDISAQTQSEMSVRASREQLSLVLASAELGFWDWDLNNDVIDRNERCA
DMLGCSVDEMRHNHRIWMDSIHPDDRMAVLKSIDRHLQGHTDSHNVEYRIIRKNGETLWV
RDTGRVMQKDSSGKAIRMCGVHLDITQVRHNQEQMELAASVYNNSSEAMSVMDHKGNIIT
VNAAFADITGYSPKEVLGHHISQFYCPRNKPAFYDEVNQAIKETGRWQGEMWQQHKNGKE
YLIWLTVNTIYDAYQRPHRRVALFSDITEKKAQEQLIWQQANYDPLTKLPNRRMLLDYLD
REISLASRQNVRFALLFLDLDFFKEVNDTLGHDMGDKLLIECADRIKACIRDSDVVARLG
GDEFTVLIRDIHDVGGVERAASNILKAIAEPFQLGPDSAYISVSIGITLFPEDASTREAL
LKNADQAMYAAKEQGRNRFNYFTPSMQEQAKYRMRLIQDLRIAIEHQQFNLVYQPIVHLQ
SGKVHKAEALLRWHHPERGYISPTEFIPVAEDTGLIMEIGSWVFEHAARQCRDWHHEFGT
TIQLSVNKSPVQFRDEGENFERWVALLEELELTHGGICIEITEGLLLDASSGVAEKLLTY
RDAGIQVSLDDFGTGYSSLAYLKKFDIDYLKIDQSFTRNLENDASDRTLCEAIIVMAQKL
GMKVIAEGVETAKQQEILKAMGCDYAQGYLYSAPVSREEFETRFLKGDPNQAPQPDKPET
RKAKTRAKAPQKAQDA