Protein Info for Sama_2390 in Shewanella amazonensis SB2B

Annotation: putative transmembrane efflux transmembrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 233 to 256 (24 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 292 to 317 (26 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 320 (313 residues), 162.8 bits, see alignment E=1.6e-51 PF06779: MFS_4" amino acids 12 to 375 (364 residues), 57 bits, see alignment E=3.5e-19 PF00083: Sugar_tr" amino acids 40 to 177 (138 residues), 28.9 bits, see alignment E=8.4e-11

Best Hits

Swiss-Prot: 54% identical to YTBD_BACSU: Uncharacterized MFS-type transporter YtbD (ytbD) from Bacillus subtilis (strain 168)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 100% identity to saz:Sama_2390)

Predicted SEED Role

"Putative drug efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S888 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Sama_2390 putative transmembrane efflux transmembrane protein (RefSeq) (Shewanella amazonensis SB2B)
MPLALFALALSAFAIGTTEFVIVGLIPTMAADLNISLPSAGLLVSLYALGVAVGAPVLTA
LTGSWNRKRVLLAVMALFVLGNLLAWQAPGYATLVVARVLTGLAHGVFFSIGSTIATGLV
AKEKAASAIAIMFTGLTVALVTGVPLGTYIGQSFGWQATFLIVAMLGLLALIGSAFLVPG
NLKQPPATKLSAQLKVLTQPRLLLVYGITALGYGGTFTAFTFLAPILQTEAGFSAGAIGL
IMLVYGVSVAVGNIWGGKMADKMGPIKALTVIFSGLAAILLVFNFTAYDPVLAVATILVW
GAFAFGNVPGLQVYVVTLAEKYAPDAVDVASGLNIAAFNVGIALGSWGGGEIVARSGLMH
TPWVGAAVVLLALGLTRLSGKLDSRDESPKHHCTQVA