Protein Info for Sama_2371 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13673: Acetyltransf_10
  • amino acids 30 to 143 (114 residues), 53.9 bits, E=5.8e-18
  • amino acids 203 to 310 (108 residues), 44.8 bits, E=3.5e-15
• PF00583: Acetyltransf_1
  • amino acids 36 to 133 (98 residues), 53.8 bits, E=6.8e-18
  • amino acids 185 to 290 (106 residues), 41.6 bits, E=4.2e-14
• PF13508: Acetyltransf_7
  • amino acids 55 to 133 (79 residues), 43.1 bits, E=1.4e-14
  • amino acids 212 to 292 (81 residues), 30.8 bits, E=9.3e-11
• PF08445: FR47
  • amino acids 73 to 111 (39 residues), 23.8 bits, 1.1e-08

Best Hits

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to saz:Sama_2371)

Predicted SEED Role

"PhnO protein" in subsystem Alkylphosphonate utilization

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A1S869 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Sama_2371 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MQIVPLHSSHYPHIASVFHQAVRAAAGKGYTQAQCEAWSRGVRDRRYWRSRLGRSLVLVA
LNVDEVVGFIDCELEHPDKGYIGHLYVAPTHQGRGIGGKLLDALIRQAPALGIGSLTTDA
SLHSEPLFAAKGFSNVGRYFQQKSGQVLPGFAMTLPLPFYIDRMQGSDLASIARLFHEAV
QGASEYYSEAERHAWSAALRDEATWQGKLAPSKVWVARKDSGIMGFINLLPKSIGEAEID
CLFTSPVLTRCGVATSLYWVLEQQARRDGVRRLSVEASYFARPFFQSRGFTELSRNEHPR
HGQILVNFSMEKWLSRPEGG