Protein Info for Sama_2365 in Shewanella amazonensis SB2B

Name: ispG
Annotation: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR00612: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase" amino acids 9 to 350 (342 residues), 412.1 bits, see alignment E=1.1e-127 PF04551: GcpE" amino acids 13 to 251 (239 residues), 362.8 bits, see alignment E=9.2e-113 PF26540: GcpE_C" amino acids 266 to 354 (89 residues), 89.1 bits, see alignment E=1.6e-29

Best Hits

Swiss-Prot: 100% identical to ISPG_SHEAM: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (ispG) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K03526, (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC: 1.17.7.1] (inferred from 100% identity to saz:Sama_2365)

MetaCyc: 85% identical to (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase (flavodoxin) (Escherichia coli K-12 substr. MG1655)
RXN-15878 [EC: 1.17.7.3]

Predicted SEED Role

"1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase (EC 1.17.7.1)" in subsystem Isoprenoid Biosynthesis (EC 1.17.7.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.7.1 or 1.17.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S863 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Sama_2365 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (RefSeq) (Shewanella amazonensis SB2B)
MFNENPIKRRPSTRIYVGNVPIGDGAPIAVQSMTNTRTTDVAATVAQIRALENVGADIVR
VSVPTMDAAEAFRQIKQQVKVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGNEERIRA
VVDCARDKNIPIRIGVNGGSLEKDLMDKYKEPTPEALLESAMRHVDILDRLNFDQFKVSV
KASDVFLAVESYRLLAKQIKQPLHLGITEAGGARAGAVKSAVGLGMLLAEGIGDTLRISL
AADPVEEVKVGFDILKSLRIRSRGINFIACPSCSRQEFDVISTVNELERRLEDVTTAMDV
SIIGCVVNGPGEALVSHLGLAGGHKKSGYYDDGIRQKERFDNDNLVDALEAKIRAKASLM
ANRIPVQEGDAD