Protein Info for Sama_2348 in Shewanella amazonensis SB2B

Annotation: cytochrome bd-I oxidase subunit II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details amino acids 335 to 360 (26 residues), see Phobius details TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 1 to 379 (379 residues), 579.4 bits, see alignment E=1.9e-178 PF02322: Cyt_bd_oxida_II" amino acids 7 to 362 (356 residues), 367.7 bits, see alignment E=2.5e-114

Best Hits

Swiss-Prot: 65% identical to CYDB_ECOL6: Cytochrome bd-I ubiquinol oxidase subunit 2 (cydB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to saz:Sama_2348)

MetaCyc: 65% identical to cytochrome bd-I subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S847 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Sama_2348 cytochrome bd-I oxidase subunit II (RefSeq) (Shewanella amazonensis SB2B)
MFDYEVLRFIWWALVGVLFIGFAVTDGFDMGVGALLPVIGKDDTDRRVMINTVAPHWDGN
QVWLITAGGALFAAWPMVYAVSFSGFYVAMVIVLLALFLRPVGFDYRSKIEAPKWRKSWD
WALFVGSFVPPLIIGVAFGNLLQGVPFNFDEFLRAKYHGGLFGLLNPFGLLAGLVSVSMF
MMQGATWLQMKTEGELRVRATNAAQLLALLLVVLFAAAGFWVANGIDGYVITSAIDTHAA
SNPVGKTVELVSGAWMANYQTYPITMAFPVLGLAMPVLVILASRFNRSGFAFLFSSLAVA
GVILTCGAAMFPFVMPSSLEPGVSLTMWDATASEMTLTVMTWAAIIFVPIVLSYTIWTYY
KMYGRLSRQFIDNNKHSLY