Protein Info for Sama_2332 in Shewanella amazonensis SB2B

Annotation: UDP-N-acetylglucosamine 2-epimerase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 44% identical to NEUCH_CAMJE: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (hydrolyzing) (legG) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 100% identity to saz:Sama_2332)

MetaCyc: 44% identical to GDP-2,4-diacetamido-2,4,6-trideoxy-alpha-D-glucopyranose hydrolase/2-epimerase (Campylobacter jejuni jejuni NCTC 11168 = ATCC 700819)
3.2.1.-

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

CMP-N-acetylneuraminate biosynthesis II (bacteria) (3/3 steps found)
UDP-N-acetyl-α-D-mannosamine biosynthesis (1/1 steps found)
CMP-N-acetylneuraminate biosynthesis I (eukaryotes) (2/5 steps found)
CMP-legionaminate biosynthesis I (4/10 steps found)
superpathway of CMP-sialic acids biosynthesis (4/15 steps found)
superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (10/24 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.14

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S831 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Sama_2332 UDP-N-acetylglucosamine 2-epimerase (RefSeq) (Shewanella amazonensis SB2B)
MRKISVVTATRAEYGLLRGLLEDINAASELELQLIVTGTHLSPEFGLTLRQIEEDGFCIN
KKVEILLSSDTAVGVSKSMGLALISFAEVFDELKPDILVVLGDRYELIPIVSAANIARIP
VAHLSGGELTEGAIDELIRHSVTKMSQLHFTAMEEYSRRVVQMGELPSRVFTVGEIGLDN
LKRIQLSSKVEFENSIHRKLMPKNLLITYHPETTQEVEKVRNDFELILKALDQLDNTLLI
FTNANSDVGGRSVNMMIDEYVDSHPEKSIAFTSLGVKRYLSALQYVDAVVGNSSSGIVEA
PSFRIATINIGERQKGRVRASSVVDVDVDSEQILKALEAIYSDDFKAHLKETVNPYGKGD
SVQKVIAVLKSVDLDSLKRKPFYDLTIG