Protein Info for Sama_2331 in Shewanella amazonensis SB2B

Annotation: N-acylneuraminate-9-phosphate synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03569: N-acetylneuraminate synthase
  • amino acids 4 to 332 (329 residues), 478.5 bits, E=4.8e-148
• PF03102: NeuB
  • amino acids 24 to 266 (243 residues), 307.7 bits, E=5.5e-96
• PF08666: SAF
  • amino acids 281 to 332 (52 residues), 35.9 bits, 9.3e-13

Best Hits

Swiss-Prot: 50% identical to NEUBH_CAMJE: N,N'-diacetyllegionaminic acid synthase (legI) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K01654, N-acetylneuraminate synthase [EC: 2.5.1.56] (inferred from 100% identity to saz:Sama_2331)

MetaCyc: 50% identical to N,N-diacetyllegionaminate synthase (Campylobacter jejuni jejuni NCTC 11168 = ATCC 700819)
RXN-12238 [EC: 2.5.1.101]

Predicted SEED Role

"N-acetylneuraminate synthase (EC 2.5.1.56)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 2.5.1.56)

MetaCyc Pathways

• CMP-N-acetylneuraminate biosynthesis II (bacteria) (3/3 steps found)
• CMP-legionaminate biosynthesis II (1/3 steps found)
• CMP-legionaminate biosynthesis I (4/10 steps found)
• superpathway of CMP-sialic acids biosynthesis (4/15 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.101 or 2.5.1.56

Sequence Analysis Tools

See A1S830 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Sama_2331 N-acylneuraminate-9-phosphate synthase (RefSeq) (Shewanella amazonensis SB2B)
MVKTFIIAEAGVNHNGNIALAKQLIDSAVEAGVDAVKFQTWKTELLVSKDAEMAAYQIEN
THKKESQFEMLKRLELSYPDFIELKAYCDTKNILFLSTPDEHESARFLNGLQSVFKIGSG
ELTNVPFLRLIAGFGKPVILSTGMGYLSEVEQALFVLTEAGLALTDITVLHATTDYPTAP
QDVNLRAMLTIQNAFPGVKVGYSDHTLGIEVSVAAVALGASIIEKHFTLDKAMPGPDHKA
SLEPAELKALVQAIRNVEASLGDGRKLPTSTEMVNRKLVRKSIIANTYISAGTEITADML
DVRRPGDGISPSRWDEVIGSIAKKDYQSGDLI