Protein Info for Sama_2327 in Shewanella amazonensis SB2B

Annotation: putative methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details PF08269: dCache_2" amino acids 51 to 197 (147 residues), 121.9 bits, see alignment E=7.8e-39 PF17200: sCache_2" amino acids 51 to 202 (152 residues), 129.3 bits, see alignment E=3.1e-41 PF17201: Cache_3-Cache_2" amino acids 103 to 199 (97 residues), 42.5 bits, see alignment E=1.3e-14 PF00672: HAMP" amino acids 221 to 273 (53 residues), 36.5 bits, see alignment 1.2e-12 PF00015: MCPsignal" amino acids 337 to 520 (184 residues), 149.9 bits, see alignment E=1.7e-47

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to saz:Sama_2327)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S826 at UniProt or InterPro

Protein Sequence (554 amino acids)

>Sama_2327 putative methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella amazonensis SB2B)
MLSNIEVLMLGHYLRNYNISRRIWVMLLLSLVATLLMFVFALRNMDTVLVQEKEARLNAL
TDIAISIITDFQGKAQSGELSEADAKAKALSALDNLRYSGKEYYFTIDRQGMMIQHPFAK
KLVDTNVLGMADPNGVKLFAEMIRLTQNSDSALVNYMWNQPDADAPSPKMSVVKRFSEWG
WIVGTGIYVDDIAAQKQEFTWQYLLVFLLVWGPVMALLLMISRSVTEPLQRTLMAFKNIA
EGEANLTLRLEERGRDELSQVSVYFNAFVGRIQSLVISVRDSVDHSRQLSSSLSNVAHQA
AHATNSMQQETQSVAAAINQMSATASEVAANAQLAAKSAKNADSQADSTNLVVTHAMGNV
RQLSSELEETSEIAKALKVSSGEIGQILDVIVGIAEQTNLLALNAAIEAARAGEAGRGFA
VVADEVRTLASRTQQSTQEINAIIEAIRGAVDKVNASVARARQQSDNTVDETAQVMDALG
LIKQAIGQINDMNLQIATATDEQSAVIAELNENINRINEISVENLSKSETVGHTSDRIAE
DSRQMAQLIAVFKV